HDGFL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HDGFL1 Polyclonal antibody, PBS Only (31923-1-PBS)

• 

  WB analysis using 31923-1-AP (same clone as 31923-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31923-1-AP (HDGFL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31923-1-PBS in a different storage buffer formulation.

HDGFL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31923-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

HDGF (Hepatoma-Derived Growth Factor) Like , HDGF Like 1 , Hdgfrp1, Hepatoma-derived growth factor-like protein 1, HRP-1

---

Product Information

31923-1-PBS targets HDGFL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36944

  Product name: Recombinant human HDGFL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-251 aa of NM_138574

  Sequence: GSGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEEEKGPLKRSAGDPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVAVENGSAPSEPGLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDSL

• Full Name: hepatoma derived growth factor-like 1
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_138574
• Gene Symbol: HDGFL1
• Gene ID (NCBI): 154150
• RRID: AB_3670147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TGJ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Hepatoma-derived growth factor-like 1 (HDGFL1, also known as HRP-1, PWWP1, and Hdgfrp1) is a member of the hepatoma-derived growth factor (HDGF) family related to tumorigenesis and the development of cancer (PMID: 18823380;  20509080). It is specifically expressed in the testis and activated in the nucleus (PMID: 22217008).