CoraLite®594-conjugated HE4 Monoclonal antibody

HE4 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66557
Clone No.5B2D9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

WFDC2, 5B2D9, Epididymal secretory protein E4, Major epididymis-specific protein E4, WAP four disulfide core domain protein 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSKOV-3 cells
Positive FC (Intra) detected inSKOV-3 cells, OVCAR-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66557 targets HE4 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5936

Product name: Recombinant human HE4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 21-124 aa of BC046106

Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Predict reactive species
Full Name WAP four-disulfide core domain 2
Calculated Molecular Weight 13 kDa
GenBank Accession NumberBC046106
Gene Symbol HE4
Gene ID (NCBI) 10406
RRIDAB_2920004
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14508
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.

Protocols

Product Specific Protocols
FC protocol for CL594 HE4 antibody CL594-66557Download protocol
IF protocol for CL594 HE4 antibody CL594-66557Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...