HEATR6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HEATR6 Polyclonal antibody, PBS Only (22560-1-PBS)

• 

  WB analysis using 22560-1-AP (same clone as 22560-1-PBS)

  MCF-7 cells lysate was subjected to SDS PAGE followed by western blot with 22560-1-AP (HEATR6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22560-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 22560-1-AP (same clone as 22560-1-PBS)

  IP result of anti-HEATR6 (IP:22560-1-AP, 4 ug; Detection:22560-1-AP 1:1000) with MCF-7 cells lysate 1520 ug. This data was developed using the same antibody clone with 22560-1-PBS in a different storage buffer formulation.

HEATR6 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 22560-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

ABC1, HEAT repeat containing 6, HEAT repeat-containing protein 6

---

Product Information

22560-1-PBS targets HEATR6 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18437

  Product name: Recombinant human HEATR6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 832-1181 aa of BC119813

  Sequence: AATSRALGVYVLFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQEEFSGLLLLKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQALISTVLTEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVVTSCKNFKVRIRSAAALSVPGKREQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGALPGLTNQ

• Full Name: HEAT repeat containing 6
• Calculated Molecular Weight: 1181 aa, 129 kDa
• Observed Molecular Weight: 129 kDa
• GenBank Accession Number: BC119813
• Gene Symbol: HEATR6
• Gene ID (NCBI): 63897
• RRID: AB_3742072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6AI08
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HEAT repeat-containing protein 6 (HEATR6) is amplified in certain breast cancer cell lines, such as MCF-7 and BT-474, suggesting its role in cancer progression. Additionally, HEATR6 is implicated in the regulation of gene expression, particularly in the context of long non-coding RNAs (lncRNAs) associated with breast cancer (PMID: 30953646).