HIF2α/EPAS1 Monoclonal antibody, PBS Only

HIF2α/EPAS1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66731-1-PBS
Clone No.2F6B12

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

bHLHe73, ECYT4, EPAS 1, EPAS1, HIF 1 alpha like factor, HIF 2 alpha, HIF2 alpha, HIF2A, HIF-2A, HIF2α, HIF-2α, HLF, Member of PAS protein 2, MOP2, PASD2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66731-1-PBS targets HIF2α/EPAS1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24886

Product name: Recombinant human EPAS1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 521-870 aa of BC051338

Sequence: FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT

Predict reactive species
Full Name endothelial PAS domain protein 1
Calculated Molecular Weight 96 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC051338
Gene Symbol HIF2α
Gene ID (NCBI) 2034
RRIDAB_2882081
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99814
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Endothelial PAS domain-containing protein 1 (EPAS1), also known as Hypoxia-inducible factor 2-alpha (HIF2-alpha,HIF2A), is a transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD. EPAS1 is expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells.

Loading...
||
New chat Able
正在加载,请稍候...