Use Able AI chat for product recommendations

CoraLite® Plus 750-conjugated HLA-DMA Recombinant monoclonal antibody

HLA-DMA Uni-rAb® Recombinant Antibody for WB

Cat No. CL750-82899-2
Clone No.230155E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB

hCG_2001572, DMA protein MHC class II antigen Major histocompatibility complex, class II, DM alpha cDNA FLJ75740, highly similar to Homo sapiens major histocompatibility complex, class II, DM alpha, DMA protein, DMA, D6S222E

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, Ramos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-82899-2 targets HLA-DMA in WB applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2452

Product name: Recombinant human HLA-DMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-261 aa of BC026279

Sequence: LPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD

Predict reactive species
Full Name major histocompatibility complex, class II, DM alpha
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC026279
Gene Symbol HLA-DMA
Gene ID (NCBI) 3108
RRIDAB_3673744
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ31604
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are composed of two non-covalently associated alpha and beta chains. HLA-DMA and HLA-DMB form a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA-DM plays a critical role in catalyzing the release of Class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 HLA-DMA antibody CL750-82899-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...