Home
Products
Primary Antibodies
HNRNPA3 Polyclonal antibody, PBS Only (25142-1-PBS)

Filter: AllWBIHCIF-PIF/ICC

WB analysis of Jurkat using 25142-1-AP (same clone as 25142-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 25142-1-AP (HNRNPA3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 25142-1-AP (same clone as 25142-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 25142-1-AP (HNRNPA3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
WB analysis of mouse lung using 25142-1-AP (same clone as 25142-1-PBS)
mouse lung tissue were subjected to SDS PAGE followed by western blot with 25142-1-AP (HNRNPA3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 25142-1-AP (same clone as 25142-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 25142-1-AP (HNRNPA3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 25142-1-AP (same clone as 25142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon slide using 25142-1-AP (HNRNPA3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
IHC staining of human stomach using 25142-1-AP (same clone as 25142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 25142-1-AP (HNRNPA3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 25142-1-AP (same clone as 25142-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse colon tissue using HNRNPA3 antibody (25142-1-AP) at dilution of 1:200, E-cadherin antibody (20874-1-AP, Magenta), CoraLite®594 smooth muscle actin antibody (CL594-14395, red), CD45 antibody (80297-1-RR, Clone: 6O19, orange). This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 25142-1-AP (same clone as 25142-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPA3 antibody (25142-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 25142-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

HNRNPA3 Polyclonal antibody, PBS Only

Name: HNRNPA3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25142-1-PBS

HNRNPA3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 25142-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

HNRPA3, HNRNPA 3, hnRNP A3, FBRNP

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25142-1-PBS targets HNRNPA3 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18248 Product name: Recombinant human HNRNPA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-330 aa of BC113470 Sequence: MQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYN Predict reactive species
Full Name	heterogeneous nuclear ribonucleoprotein A3
Calculated Molecular Weight	378 aa, 40 kDa
Observed Molecular Weight	37-40 kDa
GenBank Accession Number	BC113470
Gene Symbol	HNRNPA3
Gene ID (NCBI)	220988
RRID	AB_2879921
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P51991
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

HNRNPA3 also named as hnRNP A3 or heterogeneous nuclear ribonucleoprotein A3 is a 378 amino acid protein, which contains 2 RRM domains and localizes in nucleus. HNRNPA3 is a component of the spliceosome C complex and play a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element.