HOPX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HOPX Polyclonal antibody, PBS Only (11419-1-PBS)

• 

  WB analysis using 11419-1-AP (same clone as 11419-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11419-1-AP (HOPX antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11419-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 11419-1-AP (same clone as 11419-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11419-1-AP (HOPX antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11419-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11419-1-AP (same clone as 11419-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11419-1-AP (HOPX antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11419-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11419-1-AP (same clone as 11419-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11419-1-AP (HOPX antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11419-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 11419-1-AP (same clone as 11419-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11419-1-AP (HOPX antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11419-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 11419-1-AP (same clone as 11419-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11419-1-AP (HOPX antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11419-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HOPX Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11419-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11419-1-PBS targets HOPX in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1979

  Product name: Recombinant human HOPX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC014225

  Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID

• Full Name: HOP homeobox
• Calculated Molecular Weight: 73 aa, 8 kDa
• Observed Molecular Weight: 8-12 kDa
• GenBank Accession Number: BC014225
• Gene Symbol: HOPX
• Gene ID (NCBI): 84525
• RRID: AB_10693525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HOPX (Homeodomain-only protein) gene has various synonyms including HOD, HOP, OB1, LAGY and NECC1. The protein encoded by this gene is an unusual homeodomain protein that lacks certain conserved residues required for DNA binding. HOPX has diverse effects on cardiac growth. Manipulation of Hopx function in murine models is associated with cardiac hypertrophy, dilation and fibrosis. HOPX protein acts as an antagonist to the serum response factor (SRF), which regulates the opposing processes of cell proliferation and differentiation. Overexpression of HOPX causes cardiac hypertrophy. HOPX protein can inhibit SRF-dependent transcriptional activation by recruiting histone deacetylase (HDAC) activity.