CoraLite®594-conjugated HPGD Monoclonal antibody

• 

  IF Staining of A549 using CL594-66798

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite®594 HPGD antibody (CL594-66798, Clone: 3F1F5 ) at dilution of 1:200.

HPGD Monoclonal Antibody for IF/ICC

Cat No. CL594-66798

Clone No.3F1F5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF/ICC

Synonyms

15 PGDH, HPGD, PGDH, PGDH1, Prostaglandin dehydrogenase 1, SDR36C1

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66798 targets HPGD in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1499

  Product name: Recombinant human HPGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC018986

  Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

• Full Name: hydroxyprostaglandin dehydrogenase 15-(NAD)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC018986
• Gene Symbol: HPGD
• Gene ID (NCBI): 3248
• RRID: AB_2920040
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15428
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

HPGD, also named as PGDH (15-hydroxyprostaglandin dehydrogenase), a prostaglandin-degrading enzyme that physiologically antagonizes COX-2 (PMID:15574495). HPGD inhibits in vivo proferation of colon cancer cells (PMID:24760190). HPGD has five isoforms with the molecular mass of 29, 21, 19, 16 and 15 kDa.