CoraLite® Plus 488-conjugated HSD17B4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated HSD17B4 Recombinant monoclonal antibody (CL488-86334-2)

• 

  IF Staining of HeLa using CL488-86334-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 HSD17B4 antibody (CL488-86334-2, Clone: 251058E1 ) at dilution of 1:200.

HSD17B4 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86334-2

Clone No.251058E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

(3R)-hydroxyacyl-CoA dehydrogenase, 17 beta HSD 4, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, D bifunctional protein

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86334-2 targets HSD17B4 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7165

  Product name: Recombinant human HSD17B4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 436-736 aa of BC003098

  Sequence: GSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL

• Full Name: hydroxysteroid (17-beta) dehydrogenase 4
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 75 kDa, 45 kDa
• GenBank Accession Number: BC003098
• Gene Symbol: HSD17B4
• Gene ID (NCBI): 3295
• RRID: AB_3747839
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51659
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

HSD17B4 (17-beta-hydroxysteroid dehydrogenase 4) is also named as Peroxisomal multifunctional enzyme type 2, D-bifuntional protein or multifunctional protein 2. It codes for a 80 kDa enzyme containing three distinct functional domains and is localized in peroxisomes. It is a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids and catalyzing the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-brancked-chian fatty acids. After peroxisomal import, the full-length protein is proteolytically cleaved to yield a 35-kDa dehydrogenase subunit and a 45-kDa hydratase subunit containing the hydratase and SCP domains (PMID: 28868548, 24602372).