HSD17B8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HSD17B8 Polyclonal antibody, PBS Only (16752-1-PBS)

• 

  WB analysis using 16752-1-AP (same clone as 16752-1-PBS)

  Hela cells lysates were subjected to SDS PAGE followed by western blot with 16752-1-AP (HSD17B8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 16752-1-AP (same clone as 16752-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 16752-1-AP (HSD17B8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16752-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16752-1-AP (HSD17B8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 16752-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 16752-1-AP (HSD17B8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 16752-1-AP (same clone as 16752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16752-1-AP (same clone as 16752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16752-1-AP (same clone as 16752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16752-1-AP (same clone as 16752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16752-1-AP (same clone as 16752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16752-1-AP (same clone as 16752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16752-1-PBS in a different storage buffer formulation.

HSD17B8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16752-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

---

Product Information

16752-1-PBS targets HSD17B8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10226

  Product name: Recombinant human HSD17B8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC008185

  Sequence: MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM

• Full Name: hydroxysteroid (17-beta) dehydrogenase 8
• Calculated Molecular Weight: 261 aa, 27 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008185
• Gene Symbol: HSD17B8
• Gene ID (NCBI): 7923
• RRID: AB_2248540
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92506
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.