• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HSPB11 Monoclonal antibody

HSPB11 Monoclonal Antibody for FC (Intra)
Cat No. CL488-68059
Clone No.2D11B3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

2D11B3, C1orf41, CFAP232, FAP232, Heat shock protein beta 11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68059 targets HSPB11 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8804

Product name: Recombinant human HSPB11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-144 aa of BC005245

Sequence: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Predict reactive species
Full Name heat shock protein family B (small), member 11
Calculated Molecular Weight 144 aa, 16 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC005245
Gene Symbol HSPB11
Gene ID (NCBI) 51668
RRIDAB_2923875
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y547
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSPB11 (Heat shock protein beta-11), also known as IFT25, was originally identified as a small heat shock protein. Recently it has been identified as a component of IFT complex B. It has been demonstrated that IFT25 is not required for ciliary assembly but is required for proper Hedgehog signaling, which in mammals occurs within cilia. Cilia lacking IFT25 have defects in the signal-dependent transport of multiple Hedgehog components and fail to activate the pathway upon stimulation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 HSPB11 antibody CL488-68059Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...