HURP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HURP Polyclonal antibody, PBS Only (12038-1-PBS)

• 

  WB analysis using 12038-1-AP (same clone as 12038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12038-1-AP (HURP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12038-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 12038-1-AP (same clone as 12038-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 12038-1-AP (HURP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12038-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HURP Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 12038-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

DAP-5, Discs large homolog 7, Disks large-associated protein 5, Disks large-associated protein DLG7, DLG7

---

Product Information

12038-1-PBS targets HURP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2667

  Product name: Recombinant human HURP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 498-847 aa of BC010658

  Sequence: IKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF

• Full Name: discs, large (Drosophila) homolog-associated protein 5
• Calculated Molecular Weight: 846 aa, 95 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC010658
• Gene Symbol: HURP
• Gene ID (NCBI): 9787
• RRID: AB_10665363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15398
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DLGAP5, also named as DAP 5 or DLG7, is a kinetochore protein that stabilizes microtubules in vicinity of chromosomes. DLG7 controls spindle dynamics, promotes interkinetochore tension and efficient kinetochore capture. DGL7 is a part of Ran-dependent complex. Expression of DGL7 is found in cancer and stem cells. DLGAP5 contributes to hepatocellular carcinoma tumorigenesis by promoting cell proliferation (PMID: 24324629).