Mouse Hif-1 alpha Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 82989-4-RR (same clone as 82989-4-PBS)

  Cobalt Chloride treated NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 82989-4-RR (Hif1a antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82989-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 82989-4-RR (same clone as 82989-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 82989-4-RR (Hif-1 alpha antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82989-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82989-4-RR

  Biolayer interferometry (BLl) kinetic assays of 82989-4-RR against Mouse Hif1a were performed. The affinity constant is below 1 pM.

Hif-1 alpha Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82989-4-PBS

Clone No.230101E8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Hif1a, 230101E8, ARNT-interacting protein, Hif-1a, HIF1alpha

---

Product Information

82989-4-PBS targets Hif-1 alpha in WB, IHC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33620

  Product name: Recombinant mouse Hif1a protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 530-825 aa of NM_001313919

  Sequence: SEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQG*

• Full Name: hypoxia inducible factor 1, alpha subunit
• Calculated Molecular Weight: 93 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_001313919
• Gene Symbol: Hif1a
• Gene ID (NCBI): 15251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q61221
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.