Histone H3.3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Histone H3.3 Polyclonal antibody, PBS Only (13754-1-PBS)

• 

  WB analysis using 13754-1-AP (same clone as 13754-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13754-1-AP (Histone H3.3 antibody) at dilution of 1:1000 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13754-1-AP (same clone as 13754-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13754-1-AP (Histone H3.3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 13754-1-AP (same clone as 13754-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13754-1-AP (Histone H3.3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 13754-1-AP (same clone as 13754-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13754-1-AP (H3F3A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13754-1-AP (same clone as 13754-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13754-1-AP (H3F3A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 13754-1-AP (same clone as 13754-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13754-1-AP (H3F3A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 13754-1-AP (same clone as 13754-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13754-1-AP (Histone H3.3 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 13754-1-AP (same clone as 13754-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Histone H3.3 antibody (13754-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 13754-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Histone H3.3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13754-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

H3F3A, HistoneH3.3, Histone H3, H3-3B, H3-3A

---

Product Information

13754-1-PBS targets Histone H3.3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4696

  Product name: Recombinant human Histone H3.3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC038989

  Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

• Full Name: H3 histone, family 3A
• Calculated Molecular Weight: 136 aa, 15 kDa
• Observed Molecular Weight: 15-17 kDa
• GenBank Accession Number: BC038989
• Gene Symbol: Histone H3
• Gene ID (NCBI): 3020
• RRID: AB_2115140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84243
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Five classes of histone genes have been reported, some of which are expressed only during S phase, while others are replication independent. The latter are referred to as replacement histones and are expressed in quiescent or terminally differentiated cells. [PMID: 8586426] Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. H3F3A is one replacement histone [PMID:16258499].