CoraLite® Plus 488-conjugated Histone H4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated Histone H4 Polyclonal antibody (CL488-16047)

• 

  FC experiment of HeLa using CL488-16047

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated Histone H4 Polyclonal antibody (CL488-16047)(red), or 0.8 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

Histone H4 Polyclonal Antibody for FC (Intra)

Cat No. CL488-16047

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

H4, HIST1H4E, H4C1, H4C2, H4C3

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.8 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16047 targets Histone H4 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8999

  Product name: Recombinant human Histone H4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC012587

  Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

• Full Name: histone cluster 1, H4e
• Calculated Molecular Weight: 102 aa, 11 kDa
• Observed Molecular Weight: 11-14 kDa
• GenBank Accession Number: BC012587
• Gene Symbol: Histone H4
• Gene ID (NCBI): 8367
• RRID: AB_3083984
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62805
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Histone H4 is a 103 amino acid protein, which belongs to the histone H4 family. Histone H4 localizes in the nucleus and is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.