IBA1 Polyclonal antibody, PBS Only

• 

  IP experiment of THP-1 using 10904-1-AP (same clone as 10904-1-PBS)

  IP result of anti-IBA1 (IP:10904-1-AP, 4ug; Detection:10904-1-AP 1:500) with THP-1 cells lysate 2400 ug. This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10904-1-AP (same clone as 10904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10904-1-AP (IBA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 10904-1-AP (same clone as 10904-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using IBA1 antibody (10904-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 10904-1-AP (same clone as 10904-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using IBA1 antibody (10904-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), MAP2 antibody (17490-1-AP, orange), GFAP antibody (60190-1-Ig, Clone: 4B2E10, Magenta). This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• 

  FC experiment of THP-1 using 10904-1-AP (same clone as 10904-1-PBS)

  1X10^6 THP-1 cells were intracellularly stained with 0.4 ug Anti-Human IBA1 (10904-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10904-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.

Cat No. 10904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

AIF1, AIF 1, AIF-1, allograft inflammatory factor 1, G1

---

Product Information

10904-1-PBS targets IBA1 in IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1363

  Product name: Recombinant human IBA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC009474

  Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

• Full Name: allograft inflammatory factor 1
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: BC009474
• Gene Symbol: IBA1
• Gene ID (NCBI): 199
• ENSEMBL Gene ID: ENSG00000204472
• RRID: AB_2224377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55008
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

What is the molecular weight of IBA1?

The molecular weight of IBA1 is 16.7 kD.

 What is IBA1?

Ionized calcium-binding adaptor molecule 1 (IBA1), also known as Allograft inflammatory factor-1 (AIF-1), is an inflammation-responsive scaffold protein expressed and secreted from macrophages. Microglia response factor (MRF-1) and daintain are also similar, and likely identical, proteins (PMIDs: 29749461, 9630473, 23792284).

 What is the function of IBA1?

IBA1 is necessary for macrophage survival, and it is also a key molecule in proinflammatory activity (PMID: 29749461).

 Where is IBA1 localized?

IBA1 is a cytoplasmic protein, often expressed in immunocytes, macrophages, and microglia. It can be used as a marker for normal (not 'dark') microglia in brain tissue, as IBA1 is expressed by all microglial cell subpopulations (PMIDs: 29749461, 11943136, 26847266, 9630473).

 Is IBA1 upregulated in active immunophages?

Yes; its expression is associated with inflammatory activity (PMID: 29749461).

 How do IBA1-positive microglia differ from microglia that express less or no IBA1?

'Dark' microglia is a recently described phenotype associated with Alzheimer's disease pathology and chronic stress; these dark microglia express decreased IBA1 (often punctiform), and show distinct ultrastructural differences from 'normal' microglia as well as condensed and electron-dense cytoplasm and nucleoplasm. Normal microglia generally display strong, diffuse expression of IBA1. IBA1-positive microglial processes in normal conditions also have a strong tendency to exclusively contact synaptic elements, such as axon terminals, dendritic spines, and synaptic clefts (PMIDs: 29992181, 26847266).

 How is IBA1 related to Alzheimer's disease and pain?

Exacerbated immunoactivity of IBA1, particularly in proximity to amyloid plaques, is prominently featured in AD pathology. IBA1, along with other microglial markers, are also associated with pain, and robust microglial reactions often follow spinal cord injury (PMIDs: 29992181, 23792284).