• Featured Product
  • KD/KO Validated

IBA1 Polyclonal antibody, PBS Only

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.

Cat No. 10904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, FC (Intra), IP, ELISA

AIF1, AIF 1, AIF-1, allograft inflammatory factor 1, G1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

10904-1-PBS targets IBA1 in IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1363

Product name: Recombinant human IBA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC009474

Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predict reactive species
Full Name allograft inflammatory factor 1
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC009474
Gene Symbol IBA1
Gene ID (NCBI) 199
ENSEMBL Gene IDENSG00000204472
RRIDAB_2224377
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55008
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

What is the molecular weight of IBA1?

The molecular weight of IBA1 is 16.7 kD.


 What is IBA1?

Ionized calcium-binding adaptor molecule 1 (IBA1), also known as Allograft inflammatory factor-1 (AIF-1), is an inflammation-responsive scaffold protein expressed and secreted from macrophages. Microglia response factor (MRF-1) and daintain are also similar, and likely identical, proteins (PMIDs: 29749461, 9630473, 23792284).


 What is the function of IBA1?

IBA1 is necessary for macrophage survival, and it is also a key molecule in proinflammatory activity (PMID: 29749461).


 Where is IBA1 localized?

IBA1 is a cytoplasmic protein, often expressed in immunocytes, macrophages, and microglia. It can be used as a marker for normal (not 'dark') microglia in brain tissue, as IBA1 is expressed by all microglial cell subpopulations (PMIDs: 29749461, 11943136, 26847266, 9630473).


 Is IBA1 upregulated in active immunophages?

Yes; its expression is associated with inflammatory activity (PMID: 29749461).


 How do IBA1-positive microglia differ from microglia that express less or no IBA1?

'Dark' microglia is a recently described phenotype associated with Alzheimer's disease pathology and chronic stress; these dark microglia express decreased IBA1 (often punctiform), and show distinct ultrastructural differences from 'normal' microglia as well as condensed and electron-dense cytoplasm and nucleoplasm. Normal microglia generally display strong, diffuse expression of IBA1. IBA1-positive microglial processes in normal conditions also have a strong tendency to exclusively contact synaptic elements, such as axon terminals, dendritic spines, and synaptic clefts (PMIDs: 29992181, 26847266).


 How is IBA1 related to Alzheimer's disease and pain?

Exacerbated immunoactivity of IBA1, particularly in proximity to amyloid plaques, is prominently featured in AD pathology. IBA1, along with other microglial markers, are also associated with pain, and robust microglial reactions often follow spinal cord injury (PMIDs: 29992181, 23792284).


Loading...
||
New chat

Able

正在加载,请稍候...