IFI30 Recombinant monoclonal antibody, PBS Only

IFI30 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85982-1-PBS
Clone No.250400A4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

EC:1.8.-.-, Gamma-interferon-inducible lysosomal thiol reductase, Gamma-interferon-inducible protein IP-30, GILT, IFI 30

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85982-1-PBS targets IFI30 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2178

Product name: Recombinant human IFI30 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-260 aa of BC021136

Sequence: CSRHTFAPAAMTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

Predict reactive species
Full Name interferon, gamma-inducible protein 30
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight30-35 kDa
GenBank Accession NumberBC021136
Gene Symbol IFI30
Gene ID (NCBI) 10437
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13284
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IFI30(interferon, gamma-inducible protein 30) is also named as IP30, GILT, IFI-30, MGC32056, IFI30 and belongs to the GILT family. It can facilitate the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. IFI30 is inducibly up-regulated by IFN-g, as are MHC class II molecules, the associated invariant chain, and HLA-DM, which catalyses peptide loading in MIICs and the 35 kDa species is the IFI30 proform, and the 30-kDa species is the mature form(PMID:10639150). It can exsit as a dimer(PMID:17142755).

Loading...
||
New chat Able
正在加载,请稍候...