CoraLite® Plus 488-conjugated IFI35 Recombinant monoclonal antibody

IFI35 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83160-2
Clone No.240063C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

interferon induced protein 35, IFP35, IFP 35, Ifi-35, Ifi 35

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83160-2 targets IFI35 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34653

Product name: Recombinant human IFI35 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-203 aa of BC001356

Sequence: RKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP

Predict reactive species
Full Name interferon-induced protein 35
Calculated Molecular Weight 31 kDa
GenBank Accession NumberBC001356
Gene Symbol IFI35
Gene ID (NCBI) 3430
RRIDAB_3673206
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP80217
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IFI35 (interferon induced protein 35), also known as IFP35. It is expected to be located in cytoplasm, nucleus and extracellular space. The protein is expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. And the calculated molecular weight of IFI35 is 31 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IFI35 antibody CL488-83160-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...