Use Able AI chat for product recommendations

PE Anti-Human IGF1 Rabbit Recombinant Antibody

IGF1 Uni-rAb® Recombinant Antibody for FC (Intra)

Cat No. PE-98889-3
Clone No. 252943B2
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

IGF-1, IGF I, IGFI, IGF-I, Insulin like growth factor I

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  PE
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IGF1 in ?

Tested Applications

Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-98889-3 targets IGF1 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1806

Product name: recombinant human IGF1 protein

Source: mammalian cells-derived, pHZ-KIsec-N-mFc

Tag: N-mFc

Domain: 49-118 aa of NM_001111285.2

Sequence: EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

Predict reactive species
Full Name insulin-like growth factor 1 (somatomedin C)
Calculated Molecular Weight 22 kDa
GenBank Accession NumberNM_001111285.2
Gene Symbol IGF1
Gene ID (NCBI) 3479
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05019-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The Insulin like growth factor-1, also known as Somatomedin-C is a growth factor which is structurally related to insulin and is an important regulator of growth and differentiation in various tissues and cell systems. Human IGF-1 is synthesized as two precursor isoforms with N- and alternate C-terminal propeptide. The two precursor isoforms are differentially expressed by various tissues. The proteolytic cleavage of the N- and C-terminal regions results in the mature IGF-1 protein which is identical between isoforms. IGF-1 binds to IGF-1 receptor and induces receptor autophosphorylation. This further phosphorylates Insulin receptor substrate -1 (IRS-1) and activates various downstream signaling pathways including the PI3-AKT, MAPK etc. (PMID: 17354613, 17113337, 29535161)

Protocols

Product Specific Protocols
FC protocol for PE IGF1 antibody PE-98889-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able™

正在加载,请稍候...