IGF2BP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IGF2BP1 Recombinant monoclonal antibody (88123-1-RR)

• 

  WB analysis using 88123-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88123-1-RR (IGF2BP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A375 using 88123-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using IGF2BP1 antibody (88123-1-RR, Clone: 260323A4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

IGF2BP1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88123-1-RR

Clone No.260323A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Coding region determinant-binding protein, CRD-BP, IGF2 mRNA-binding protein 1, IGF2BP 1, IGF-II mRNA-binding protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, K-562 cells, Caco-2 cells, IMR-32 cells, 3T3-L1 cells
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88123-1-RR targets IGF2BP1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18859

  Product name: Recombinant human IGF2BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-198 aa of BC156957

  Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL

• Full Name: insulin-like growth factor 2 mRNA binding protein 1
• Calculated Molecular Weight: 577 aa, 63 kDa
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC156957
• Gene Symbol: IGF2BP1
• Gene ID (NCBI): 10642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZI8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa.