IgG Kappa Light Chain Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IgG Kappa Light Chain Polyclonal antibody (11781-1-AP)

IgG Kappa Light Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 11781-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

IGKV15, IGKV, IGKV1 5, IGKV1-5, L12

• 

  WB analysis of human plasma using 11781-1-AP

  human plasma (0.3ug) were subjected to SDS PAGE followed by western blot with 11781-1-AP (IgG light chain (Kappa) Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 11781-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11781-1-AP (IgG light chain (Kappa) antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 11781-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11781-1-AP (IgG light chain (Kappa) antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 11781-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 11781-1-AP (IgG light chain (Kappa) antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11781-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11781-1-AP (IgG Kappa Light Chain antibody) at dilution of 1:1000 (under 4x lens). heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 11781-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using IgG Kappa Light Chain antibody (11781-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human plasma tissue, A549 cells, K-562 cells, mouse spleen tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11781-1-AP targets IgG Kappa Light Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2406

  Product name: Recombinant human IGKV1-5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC030814

  Sequence: MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGIYYCMQGLQTPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNTLQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

• Full Name: immunoglobulin kappa variable 1-5
• Calculated Molecular Weight: 239 aa, 26 kDa
• Observed Molecular Weight: 26 kDa, 13 kDa
• GenBank Accession Number: BC030814
• Gene Symbol: IgG Kappa Light Chain
• Gene ID (NCBI): 28299
• RRID: AB_10953529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detects the kappa light chain of human IgG.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Arthritis Res Ther; Rspo2 exacerbates rheumatoid arthritis by targeting aggressive phenotype of fibroblast-like synoviocytes and disrupting chondrocyte homeostasis via Wnt/β-catenin pathway; Authors - Dong Guo