CoraLite® Plus 488-conjugated IgG Kappa Light Chain Polyclonal antibody

• 

  IF Staining of human tonsillitis using CL488-11781

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CoraLite® Plus 488 IgG Kappa Light Chain antibody (CL488-11781) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IgG Kappa Light Chain Polyclonal Antibody for IF-P

Cat No. CL488-11781

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

IGKV15, IGKV, IGKV1 5, IGKV1-5, L12

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11781 targets IgG Kappa Light Chain in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2406

  Product name: Recombinant human IGKV1-5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC030814

  Sequence: MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSDGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGIYYCMQGLQTPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNTLQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

• Full Name: immunoglobulin kappa variable 1-5
• Calculated Molecular Weight: 239 aa, 26 kDa
• Observed Molecular Weight: 26 kDa, 13 kDa
• GenBank Accession Number: BC030814
• Gene Symbol: IgG Kappa Light Chain
• Gene ID (NCBI): 28299
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

This antibody detects the kappa light chain of human IgG.