IKKA Recombinant monoclonal antibody

• 

  IF Staining of HCT 116 using 84372-5-RR

  Immunofluorescent analysis of (4% PFA) fixed HCT 116 cells using IKKA antibody (84372-5-RR, Clone: 241579D12 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of HepG2 using 84372-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IKKA Recombinant Antibody (84372-5-RR, Clone:241579D12) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

IKKA Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 84372-5-RR

Clone No.241579D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

CHUK, IKK A, IKK alpha, IKK-1, IKK-alpha

---

Tested Applications

• Positive IF/ICC detected in: HCT 116 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84372-5-RR targets IKKA in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26573

  Product name: Recombinant human CHUK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 516-620 aa of NM_001278

  Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID

• Full Name: conserved helix-loop-helix ubiquitous kinase
• Calculated Molecular Weight: 85 kDa
• GenBank Accession Number: NM_001278
• Gene Symbol: IKK Alpha
• Gene ID (NCBI): 1147
• RRID: AB_3671908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O15111
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NF‐κB is regulated by phosphorylation of one of its cytoplasmic inhibitors, IκB, mediated by IκB kinases (IKK), allowing NF‐κB nuclear translocation and transcriptional activation. IKKα‐IKKβ heterodimer complexes regulate the DNA binding proteins implicated in the canonical NF‐κB pathway, including p50‐p65, while IKKα‐homodimers regulate p52‐RELB dimers implicated in the alternative NF‐κB pathway. (PMID: 34187082)