FITC Plus Anti-Mouse IL-1 alpha Rabbit Recombinant Antibody

IL-1 alpha Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. FITC-98052
Clone No.240431G10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Il1a, IL1-alpha, 240431G10, Il 1a, IL1 alpha

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inLPS treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98052 targets IL-1 alpha in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0263

Product name: Recombinant mouse IL1-alpha protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 115-270 aa of NM_010554

Sequence: MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Predict reactive species
Full Name interleukin 1 alpha
Calculated Molecular Weight31kd
GenBank Accession NumberNM_010554
Gene Symbol Il1a
Gene ID (NCBI) 16175
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01582
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

IL-1 alpha is a dual function cytokine that can function both as a transcription factor and a damage-associated molecular pattern (DAMP) in innate immune responses. It is expressed by many cell types and its expression is increased when cells are exposed to growth factors, pro-inflammatory, and stress-related signals. In its pro-form, IL-1 alpha contains a nuclear localization signal that allows it to translocate to the nucleus and bind to DNA, resulting in either the increase or prohibition of pro-inflammatory cytokine expression. When cells are exposed to necrotic signals, mature IL-1 alpha is released from the cell lysates and triggers a strong pro-inflammatory response upon binding to its receptor on nearby cells. Due to its strongly pro-inflammatory nature, IL-1 alpha has been linked to tumor metastasis and lower median survival in several cancers (PMID: 27434011, 29247995).

Loading...
||
New chat

Able

正在加载,请稍候...