• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IL-1 Beta Monoclonal antibody

IL-1 Beta Monoclonal Antibody for
Cat No. CL488-66737
Clone No.2A1B4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IL1- beta, IL1 beta, IL 1 beta, IL 1, Catabolin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66737 targets IL-1 Beta in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26030

Product name: Recombinant human IL-1B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 117-269 aa of BC008678

Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Predict reactive species
Full Name interleukin 1, beta
Calculated Molecular Weight 269 aa, 31 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC008678
Gene Symbol IL1B
Gene ID (NCBI) 3553
ENSEMBL Gene IDENSG00000125538
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01584
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.

Loading...
||
New chat

Able

正在加载,请稍候...