CoraLite®594 Anti-Human IL-10RB Rabbit Recombinant Antibody

IL-10RB Uni-rAb® Recombinant Antibody for FC
Cat No. CL594-98292
Clone No.242302D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

IL10RB, 242302D2, CDW210B, CRF2 4, CRF2-4

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98292 targets IL-10RB in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3446

Product name: Recombinant Human IL-10RB protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 20-220 aa of BC001903

Sequence: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS

Predict reactive species
Full Name interleukin 10 receptor, beta
Calculated Molecular Weight 37 kDa
GenBank Accession NumberBC001903
Gene Symbol IL10RB
Gene ID (NCBI) 3588
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08334
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A/B and IL29 (PMID: 22236434).

Protocols

Product Specific Protocols
FC protocol for CL594 IL-10RB antibody CL594-98292Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...