FITC Plus Anti-Human IL-10RB Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using FITC-98292

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 647 Anti-Human HLA-DR (L243) Mouse IgG2a Recombinant Antibody (CL647-65560, Clone: L243), and 5 ul FITC Plus Anti-Human IL-10RB Rabbit RecAb (FITC-98292, Clone: 242302D2) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using FITC-98292

  1x10^6 human PBMCs were surface stained with 5 ul FITC Plus Anti-Human IL-10RB Rabbit RecAb (FITC-98292, Clone: 242302D2) (red) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

IL-10RB Uni-rAb^® Recombinant Antibody for FC

Cat No. FITC-98292

Clone No.242302D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IL10RB, 242302D2, CDW210B, CRF2 4, CRF2-4

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98292 targets IL-10RB in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3446

  Product name: Recombinant Human IL-10RB protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-220 aa of BC001903

  Sequence: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS

• Full Name: interleukin 10 receptor, beta
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC001903
• Gene Symbol: IL10RB
• Gene ID (NCBI): 3588
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08334
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A/B and IL29 (PMID: 22236434).