Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® CoraLite® Plus 647 Anti-Human IL-12/IL-23 p40 Rabbit Recombinant Antibody

IL-12/IL-23 p40 FcZero-rAb® Recombinant Antibody for FC (Intra)

Cat No. CL647-FcA98277
Clone No.241600F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

IL12B, CLMF p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL 12 P40, IL 12 subunit p40

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inIFN gamma, LPS and Brefeldin A treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-FcA98277 targets IL-12/IL-23 p40 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0431

Product name: Recombinant Human IL-12/IL-23 p40 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 23-328 aa of BC067498

Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Predict reactive species
Full Name interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
Calculated Molecular Weight 328 aa, 37 kDa
GenBank Accession NumberBC067498
Gene Symbol IL12B
Gene ID (NCBI) 3593
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29460
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin (IL)-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 IL-12/IL-23 p40 antibody CL647-FcA98277Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...