FcZero-rAb® PE Anti-Human IL-12/IL-23 p40 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® PE Anti-Human IL-12/IL-23 p40 Rabbit Recombinant Antibody (PE-FcA98277)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

IL-12/IL-23 p40 FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. PE-FcA98277

Clone No.241600F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

IL12B, CLMF p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL 12 P40, IL 12 subunit p40

• 

  FC experiment of human PBMCs using PE-FcA98277

  1x10^6 untreated or IFN gamma, LPS and Brefeldin A treated human PBMCs were intracellularly stained with 0.1 ug PE Anti-Human IL-12/IL-23 p40 Rabbit RecAb (PE-FcA98277, Clone: 241600F8). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using PE-FcA98277

  1x10^6 IFN gamma, LPS and Brefeldin A treated human PBMCs were intracellularly stained with 0.1 ug PE Anti-Human IL-12/IL-23 p40 Rabbit RecAb (PE-FcA98277, Clone: 241600F8) (red) or FcZero-rAb® PE Rabbit IgG Isotype Control Recombinant Antibody (PE-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated human PBMCs were intracellularly stained with 5 ul PE Anti-Human IL-12/IL-23 p40 Rabbit RecAb (PE-FcA98277, Clone: 241600F8) (black, dashed). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98277 targets IL-12/IL-23 p40 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0431

  Product name: Recombinant Human IL-12/IL-23 p40 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-328 aa of BC067498

  Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

• Full Name: interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
• Calculated Molecular Weight: 328 aa, 37 kDa
• GenBank Accession Number: BC067498
• Gene Symbol: IL12B
• Gene ID (NCBI): 3593
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29460
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin (IL)-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918).