CoraLite® Plus 488-conjugated IL-4RA/CD124 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL488-67051

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CoraLite® Plus 488 IL-4RA/CD124 antibody (CL488-67051, Clone: 1E4C11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Daudi using CL488-67051

  Immunofluorescent analysis of (4% PFA) fixed Daudi cells using CoraLite® Plus 488 IL-4RA/CD124 antibody (CL488-67051, Clone: 1E4C11 ) at dilution of 1:200.

IL-4RA/CD124 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL488-67051

Clone No.1E4C11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, IF-P

Synonyms

IL4R, 1E4C11, CD124, IL 4 binding protein, IL 4 receptor subunit alpha

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue
• Positive IF/ICC detected in: Daudi cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67051 targets IL-4RA/CD124 in IF/ICC, IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28411

  Product name: Recombinant human IL-4R protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-232 aa of NM_000418

  Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

• Full Name: interleukin 4 receptor
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_000418
• Gene Symbol: IL-4R
• Gene ID (NCBI): 3566
• RRID: AB_2919413
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P24394
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation.