IL-22RA1 Polyclonal antibody

IL-22RA1 Polyclonal Antibody for WB, IF, FC (Intra), ELISA
Cat No. 13462-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

IL22RA1, CRF2 9, Cytokine receptor class-II member 9, IL 22 receptor subunit alpha 1, IL 22R alpha 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, HEK-293 cells, HepG2 cells, HT-29 cells, mouse small intestine tissue, mouse heart tissue
Positive IF detected inhuman gut
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunofluorescence (IF)IF : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13462-1-AP targets IL-22RA1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4056

Product name: Recombinant human IL-22RA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 253-574 aa of BC029273

Sequence: YVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES

Predict reactive species
Full Name interleukin 22 receptor, alpha 1
Calculated Molecular Weight 574 aa, 63 kDa
Observed Molecular Weight 63-68 kDa
GenBank Accession NumberBC029273
Gene Symbol IL-22RA1
Gene ID (NCBI) 58985
RRIDAB_2248953
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N6P7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061).

Protocols

Product Specific Protocols
FC protocol for IL-22RA1 antibody 13462-1-APDownload protocol
WB protocol for IL-22RA1 antibody 13462-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

PLoS Biol

Loss of adenomatous polyposis coli function renders intestinal epithelial cells resistant to the cytokine IL-22.

Authors - Yu Chen
humanWB

Oxid Med Cell Longev

IL-22 Protects against Biliary Ischemia-Reperfusion Injury after Liver Transplantation via Activating STAT3 and Reducing Apoptosis and Oxidative Stress Levels In Vitro and In Vivo.

Authors - Yi Bai
mouseWB,IP,IF

NPJ Regen Med

Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration

Authors - Jingyi Shen
humanWB

Clin Sci (Lond)

HMGB1-induced autophagy facilitates hepatic stellate cells activation: a new pathway in liver fibrosis.

Authors - Jing Li
humanWB

Apoptosis

Elevated IL-22 in psoriasis plays an anti-apoptotic role in keratinocytes through mediating Bcl-xL/Bax.

Authors - Bo Wang
humanIHC

Biochim Biophys Acta Mol Basis Dis

IL-22 ameliorated cardiomyocyte apoptosis in cardiac ischemia/reperfusion injury by blocking mitochondrial membrane potential decrease, inhibiting ROS and cytochrome C.

Authors - Yang Che

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Iram (Verified Customer) (06-13-2022)

Very good antibody for my western blotting

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: colon cancer cells
FH

Susmita (Verified Customer) (03-11-2022)

Excellent antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: WB: 1: 2000
  • Cell Tissue Type: PC cell line
Loading...
||
New chat Able
正在加载,请稍候...