Tested Applications
| Positive WB detected in | COLO 320 cells, HEK-293 cells, HepG2 cells, HT-29 cells, mouse small intestine tissue, mouse heart tissue |
| Positive IF detected in | human gut |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF) | IF : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13462-1-AP targets IL-22RA1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4056 Product name: Recombinant human IL-22RA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 253-574 aa of BC029273 Sequence: YVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES Predict reactive species |
| Full Name | interleukin 22 receptor, alpha 1 |
| Calculated Molecular Weight | 574 aa, 63 kDa |
| Observed Molecular Weight | 63-68 kDa |
| GenBank Accession Number | BC029273 |
| Gene Symbol | IL-22RA1 |
| Gene ID (NCBI) | 58985 |
| RRID | AB_2248953 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N6P7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-22RA1 antibody 13462-1-AP | Download protocol |
| WB protocol for IL-22RA1 antibody 13462-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-22RA1 Rabbit Polyclonal Antibody (Cat# 13462-1-AP) has 22 citations published in journals including Neuron, Cell Commun Signal, Phytomedicine, Sci China Life Sci, Apoptosis, PLoS Biol, NPJ Regen Med, and others. Research fields span neuroscience, gastroenterology, hepatology, dermatology, reproductive endocrinology, cardiology, immunology, and ophthalmology. Applications include WB, IF, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Neuron A peritumoral microenvironment engaged by Reg-EXTL3 axis fosters nerve-cancer interactions in pancreatic ductal adenocarcinoma. | ||
Cell Commun Signal Interleukin-22 receptor 1-mediated stimulation of T-type Ca2+ channels enhances sensory neuronal excitability through the tyrosine-protein kinase Lyn-dependent PKA pathway | ||
Phytomedicine Troxerutin dampened hypothalamic neuroinflammation via microglial IL-22/IL-22R1/IRF3 activation in dihydrotestosterone-induced polycystic ovary syndrome rats | ||
Sci China Life Sci Role of iron in host-microbiota interaction and its effects on intestinal mucosal growth and immune plasticity in a piglet model | ||
Apoptosis Elevated IL-22 in psoriasis plays an anti-apoptotic role in keratinocytes through mediating Bcl-xL/Bax. | ||
World J Gastroenterol Thymosin β4 released by mast cells under stress conditions impairs intestinal epithelial barrier via IL22RA1/JAK1/STAT3 signaling in irritable bowel syndrome. |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating for Western Blot applications. Iram Fatima used it at a 1:2000 dilution on colon cancer cells and described it as "very good" for her western blotting. Susmita Barman also used a 1:2000 dilution on PC cell lines and called it an "excellent antibody." Both reviews were from the same lot (00004383), and both users expressed strong satisfaction with the product's performance in WB experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Iram (Verified Customer) (06-13-2022) | Very good antibody for my western blotting
|
Susmita (Verified Customer) (03-11-2022) | Excellent antibody
|
