CoraLite® Plus 488-conjugated IL-22RA1 Polyclonal antibody

• 

  FC experiment of HepG2 using CL488-13462

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human IL-22RA1 (CL488-13462)(red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

IL-22RA1 Polyclonal Antibody for FC (Intra)

Cat No. CL488-13462

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

IL22RA1, CRF2 9, Cytokine receptor class-II member 9, IL 22 receptor subunit alpha 1, IL 22R alpha 1

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13462 targets IL-22RA1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4056

  Product name: Recombinant human IL-22RA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 253-574 aa of BC029273

  Sequence: YVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES

• Full Name: interleukin 22 receptor, alpha 1
• Calculated Molecular Weight: 574 aa, 63 kDa
• Observed Molecular Weight: 63-68 kDa
• GenBank Accession Number: BC029273
• Gene Symbol: IL-22RA1
• Gene ID (NCBI): 58985
• RRID: AB_3672567
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6P7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Interleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061).