IL-9 Polyclonal antibody

IL9 Polyclonal Antibody for ELISA
Cat No. 17689-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Cytokine P40, HP40, IL 9, IL9, interleukin 9, P40, T cell growth factor P40

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

IHCSee 1 publications below

Product Information

17689-1-AP targets IL9 in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11841

Product name: Recombinant human IL-9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-144 aa of BC066284

Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Predict reactive species
Full Name interleukin 9
Calculated Molecular Weight 144 aa, 16 kDa
GenBank Accession NumberBC066284
Gene Symbol IL9
Gene ID (NCBI) 3578
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15248
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.

Publications

SpeciesApplicationTitle
humanIHC

Int Immunopharmacol

Interleukin-9 promotes tumorigenesis through augmenting angiogenesis in non-small cell lung cancer.

Authors - Jun He
Loading...
||
New chat Able
正在加载,请稍候...