IMP5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IMP5 Polyclonal antibody, PBS Only (12664-1-PBS)

• 

  WB analysis of HEK-293 using 12664-1-AP (same clone as 12664-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12664-1-AP (IMP5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12664-1-AP (same clone as 12664-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12664-1-AP (IMP5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 12664-1-AP (same clone as 12664-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 12664-1-AP (IMP5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 12664-1-AP (same clone as 12664-1-PBS)

  IP result of anti-IMP5 (IP:12664-1-AP, 4ug; Detection:12664-1-AP 1:500) with HEK-293 cells lysate 3600ug. This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12664-1-AP (same clone as 12664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12664-1-AP (IMP5 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12664-1-AP (same clone as 12664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12664-1-AP (IMP5 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 12664-1-AP (same clone as 12664-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 12664-1-AP (IMP5 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12664-1-PBS in a different storage buffer formulation.

IMP5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12664-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EC:3.4.23.-, IMP 5, IMP-5, Signal peptide peptidase-like 2C, SPP like 2C

---

Product Information

12664-1-PBS targets IMP5 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3345

  Product name: Recombinant human IMP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 520-684 aa of BC025401

  Sequence: QELSLFWTGQGRAKMCGLGCAPSAGSRQKQEGAADAHTASTLERGTSRGAGDLDSNPGEDTTEIVTISENEATNPEDRSDSSEGWSDAHLDPNELPFIPPGASEELVPLMPMAMLIPLMPLMPPPSELGHVHAQAQAHETGLPWAGLHKRKGLKVRKSMSTQAPL

• Full Name: intramembrane protease 5
• Calculated Molecular Weight: 684 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC025401
• Gene Symbol: IMP5
• Gene ID (NCBI): 162540
• RRID: AB_2296163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.