• Featured Product
  • KD/KO Validated

INTS6 Recombinant monoclonal antibody, PBS Only (Capture)

INTS6 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 84610-3-PBS
Clone No.242099E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

242099E6, DBI 1, DBI1, DDX26, DDX26A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84610-3-PBS targets INTS6 as part of a matched antibody pair:

MP01446-1: 84610-3-PBS capture and 84610-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag36146

Product name: Recombinant human INTS6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 672-815 aa of BC039829

Sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ

Predict reactive species
Full Name integrator complex subunit 6
Calculated Molecular Weight 100 kDa
GenBank Accession NumberBC039829
Gene Symbol INTS6
Gene ID (NCBI) 26512
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UL03
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

INTS6 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.

Loading...
||
New chat Able
正在加载,请稍候...