IQGAP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IQGAP1 Polyclonal antibody, PBS Only (22167-1-PBS)

• 

  WB analysis using 22167-1-AP (same clone as 22167-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22167-1-AP (IQGAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22167-1-AP (same clone as 22167-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22167-1-AP (IQGAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SGC-7901 using 22167-1-AP (same clone as 22167-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 22167-1-AP (IQGAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 22167-1-AP (same clone as 22167-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 22167-1-AP (same clone as 22167-1-PBS)

  IP result of anti-IQGAP1 (IP:22167-1-AP, 4ug; Detection:22167-1-AP 1:8000) with HeLa cells lysate 1085 ug. This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 22167-1-AP (IQGAP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22167-1-AP (IQGAP1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22167-1-AP (same clone as 22167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22167-1-AP (IQGAP1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 22167-1-PBS

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using IQGAP1 antibody (22167-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of MCF-7 using 22167-1-AP (same clone as 22167-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using IQGAP1 antibody (22167-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 22167-1-AP (same clone as 22167-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using IQGAP1 antibody (22167-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 22167-1-AP (same clone as 22167-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using IQGAP1 antibody (22167-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22167-1-AP (same clone as 22167-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 22167-1-AP (IQGAP1 antibody) at dilution of 1:400 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22167-1-PBS

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using IQGAP1 antibody (22167-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HeLa using 22167-1-AP (same clone as 22167-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug IQGAP1 Polyclonal antibody (22167-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 22167-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IQGAP1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 22167-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

HUMORFA01, KIAA0051, p195, Ras GTPase-activating-like protein IQGAP1

---

Product Information

22167-1-PBS targets IQGAP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17821

  Product name: Recombinant human IQGAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 478-827 aa of BC151834

  Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD

• Full Name: IQ motif containing GTPase activating protein 1
• Calculated Molecular Weight: 189 kDa
• Observed Molecular Weight: 190-195 kDa
• GenBank Accession Number: BC151834
• Gene Symbol: IQGAP1
• Gene ID (NCBI): 8826
• ENSEMBL Gene ID: ENSG00000140575
• RRID: AB_10949193
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46940
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion.