IRF5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IRF5 Polyclonal antibody, PBS Only (10547-1-PBS)

• 

  WB analysis using 10547-1-AP (same clone as 10547-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 10547-1-AP (IRF5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10547-1-AP (same clone as 10547-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10547-1-AP (IRF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10547-1-AP (same clone as 10547-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10547-1-AP (IRF5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 10547-1-AP (same clone as 10547-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10547-1-AP (IRF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10547-1-AP (same clone as 10547-1-PBS)

  IP result of anti-IRF5 (IP:10547-1-AP, 4ug; Detection:10547-1-AP 1:300) with HeLa cells lysate 1600ug. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10547-1-AP (same clone as 10547-1-PBS)

  IP result of anti-IRF5 (IP:10547-1-AP, 4ug; Detection:10547-1-AP 1:300) with HeLa cells lysate 1600ug. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10547-1-AP (same clone as 10547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10547-1-AP (IRF5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10547-1-AP (same clone as 10547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10547-1-AP (IRF5 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10547-1-AP (same clone as 10547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10547-1-AP (IRF5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10547-1-AP (same clone as 10547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10547-1-AP (IRF5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10547-1-AP (same clone as 10547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10547-1-AP (IRF5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10547-1-AP (same clone as 10547-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IRF5 antibody (10547-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10547-1-AP (same clone as 10547-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IRF5 antibody (10547-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10547-1-AP (same clone as 10547-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 10547-1-AP (IRF5 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

• 

  FC experiment of THP-1 using 10547-1-AP (same clone as 10547-1-PBS)

  1x10^6 THP-1 cells were intracellularly stained with 0.25 ug IRF5 Polyclonal antibody (10547-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10547-1-PBS in a different storage buffer formulation.

IRF5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10547-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

interferon regulatory factor 5, IRF 5, IRF-5 , SLEB10

---

Product Information

10547-1-PBS targets IRF5 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0841

  Product name: Recombinant human IRF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 173-498 aa of BC004201

  Sequence: TLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

• Full Name: interferon regulatory factor 5
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC004201
• Gene Symbol: IRF5
• Gene ID (NCBI): 3663
• RRID: AB_2280474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13568
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IRF5, also named as SLEB10, contians one IRF tryptophan pentad repeat DNA-binding domain and belongs to the IRF family. It is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. It is activated by TLR7 or TLR8 signaling. Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14) and systemic lupus erythematosus type 10 (SLEB10). Alternative splice variant encoding different isoforms exist. Catalog#10547-1-AP is a rabbit polyclonal antibody raised against the C-terminal of human IRF5.