CoraLite® Plus 594-conjugated IRF8 Monoclonal antibody

IRF8 Monoclonal Antibody for IF/ICC
Cat No. CL594-67142
Clone No.3A10A4

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF/ICC

H ICSBP, ICSBP, ICSBP1, interferon regulatory factor 8, IRF 8, IRF8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67142 targets IRF8 in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19909

Product name: Recombinant human IRF8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 121-426 aa of BC126247

Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

Predict reactive species
Full Name ICSBP1
Calculated Molecular Weight 426 aa, 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC126247
Gene Symbol IRF8
Gene ID (NCBI) 3394
RRIDAB_3084750
Conjugate CoraLite® Plus 594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths594 nm / 615 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ02556
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IRF8 also named as ICSBP1, is a transcription factor of the IFN regulatory factor (IRF) family. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. IRF8 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)). It plays a negative regulatory role in cells of the immune system. It is predominantly in lymphoid tissues.

Protocols

Product Specific Protocols
IF protocol for CL Plus 594 IRF8 antibody CL594-67142Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...