CoraLite® Plus 594-conjugated IRF8 Monoclonal antibody

• 

  IF Staining of THP-1 using CL594-67142

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using CoraLite® Plus 594 IRF8 antibody (CL594-67142, Clone: 3A10A4 ) at dilution of 1:200.

IRF8 Monoclonal Antibody for IF/ICC

Cat No. CL594-67142

Clone No.3A10A4

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF/ICC

Synonyms

H ICSBP, ICSBP, ICSBP1, interferon regulatory factor 8, IRF 8, IRF8

---

Tested Applications

• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67142 targets IRF8 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19909

  Product name: Recombinant human IRF8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 121-426 aa of BC126247

  Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

• Full Name: ICSBP1
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC126247
• Gene Symbol: IRF8
• Gene ID (NCBI): 3394
• RRID: AB_3084750
• Conjugate: CoraLite® Plus 594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 594 nm / 615 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02556
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

IRF8 also named as ICSBP1, is a transcription factor of the IFN regulatory factor (IRF) family. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. IRF8 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)). It plays a negative regulatory role in cells of the immune system. It is predominantly in lymphoid tissues.