Use Able AI chat for product recommendations

Mouse CD18 Recombinant monoclonal antibody, PBS Only (Detector)

CD18 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 87481-2-PBS
Clone No.252753A4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Itgb2, integrin beta 2, LAD, LCAMB, Lfa1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87481-2-PBS targets CD18 as part of a matched antibody pair:

MP03055-1: 87481-3-PBS capture and 87481-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg10459

Product name: Recombinant mouse ITB2 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-Twin-Strep-Tag

Domain: 487-702 aa of

Sequence: P11835:QGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPN

Predict reactive species
Full Name integrin beta 2
Observed Molecular Weight 85-90 kDa
Gene Symbol CD18
Gene ID (NCBI) 16414
RRIDAB_3745573
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD18, also known as integrin beta-2, is a transmembrane protein that forms heterodimers with CD11a, CD11b, CD11c, CD11d (PMID: 1968349). CD11a/CD18 (LFA-1) is expressed by all leukocytes, while CD11b/CD18 (Mac-1) and CD11c/CD18 (p150,95) are normally restricted to expression on monocytes, macrophages, polymorphonuclear lymphocytes (PMNs), and natural killer cells (PMID: 1968349; 3109455; 10946284). CD18 plays an important role in mediating cell adhesion during the immune response, and defects of CD18 cause leukocyte adhesion deficiency (PMID: 3594570).

Loading...
||
New chat

Able

正在加载,请稍候...