ITGBL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ITGBL1 Polyclonal antibody, PBS Only (30010-1-PBS)

• 

  WB analysis using 30010-1-AP (same clone as 30010-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30010-1-AP (ITGBL1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30010-1-PBS in a different storage buffer formulation.

ITGBL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30010-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Integrin beta like protein 1, OSCP, Osteoblast-specific cysteine-rich protein, Ten integrin EGF-like repeat domain-containing protein, TIED

---

Product Information

30010-1-PBS targets ITGBL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31989

  Product name: Recombinant human ITGBL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC036788

  Sequence: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV

• Full Name: integrin, beta-like 1 (with EGF-like repeat domains)
• Calculated Molecular Weight: 494 aa, 54 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC036788
• Gene Symbol: ITGBL1
• Gene ID (NCBI): 9358
• RRID: AB_3086208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95965
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrin beta-like protein 1 (ITGBL1), also named as TIED or OSCP, is a secreted protein that contains ten tandem EGF-like repeats strikingly similar to those found in the cysteine-rich "stalk-like" structure of integrin beta subunits (PMID: 10051402). ITGBL1 participates in the regulation of fibrogenesis via interactions with transforming growth factor beta 1 (PMID: 28262670). ITGBL1 is also involved in the development and metastasis of many tumors (PMID: 32211321; 29772438; 26060017; 31190876).