ITIH3 Polyclonal antibody, PBS Only

• 

  WB analysis of human plasma using 21247-1-AP (same clone as 21247-1-PBS)

  human serum were subjected to SDS PAGE followed by western blot with 21247-1-AP (ITIH3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21247-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human plasma using 21247-1-AP (same clone as 21247-1-PBS)

  IP result of anti-ITIH3 (IP:21247-1-AP, 4ug; Detection:21247-1-AP 1:1000) with human plasma lysate 4000ug. This data was developed using the same antibody clone with 21247-1-PBS in a different storage buffer formulation.

ITIH3 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 21247-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Inter-alpha-inhibitor heavy chain 3, Inter-alpha-trypsin inhibitor heavy chain H3, ITI HC3, ITI heavy chain H3, ITI-HC3

---

Product Information

21247-1-PBS targets ITIH3 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15750

  Product name: Recombinant human ITIH3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 601-782 aa of BC107604

  Sequence: MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPEKDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQMDFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQVW

• Full Name: inter-alpha (globulin) inhibitor H3
• Calculated Molecular Weight: 890 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC107604
• Gene Symbol: ITIH3
• Gene ID (NCBI): 3699
• RRID: AB_2878830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06033
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ITIH3, or inter-alpha-trypsin inhibitor heavy chain 3, is a gene in humans that encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex plays a role in stabilizing the extracellular matrix through its ability to bind hyaluronic acid. The gene is located on chromosome 3 and is part of the inter-alpha-trypsin inhibitor family gene cluster. ITIH3 has restricted expression primarily toward the liver, with an RPKM value of 228.8, indicating a relatively high level of expression in this organ.