ITLN1/2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ITLN1/2 Polyclonal antibody, PBS Only (11770-1-PBS)

• 

  WB analysis of mouse colon using 11770-1-AP (same clone as 11770-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 11770-1-AP (ITLN1/2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11770-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse appendix using 11770-1-AP (same clone as 11770-1-PBS)

  IP result of anti-ITLN1/2 (IP:11770-1-AP, 4ug; Detection:11770-1-AP 1:500) with mouse appendix tissue lysate 4000ug. This data was developed using the same antibody clone with 11770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 11770-1-AP (same clone as 11770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11770-1-AP (ITLN1/2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11770-1-PBS in a different storage buffer formulation.

ITLN1/2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11770-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

ITLN1, HL 1, hIntL, Galactofuranose-binding lectin, Galactofuranose binding lectin

---

Product Information

11770-1-PBS targets ITLN1/2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2424

  Product name: Recombinant human ITLN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC020664

  Sequence: MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR

• Full Name: intelectin 1 (galactofuranose binding)
• Calculated Molecular Weight: 313 aa, 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC020664
• Gene Symbol: ITLN1
• Gene ID (NCBI): 55600
• RRID: AB_2129677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWA0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ITLN1, also named as Intelectin 1, has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. ITLN1 is a glycoprotein made up of three 40 kDa subunits cross-linked by disulfide bonds making up a 120-kDa homo-trimer of 295 amino acids and N-linked oligosaccharides (PMID: 17621593). It may play a role in the defense system against microorganisms. Human intelectin-1 is expressed in intestinal goblet cells, and is present at about 200 ng/mL in serum. Intelectin-1 was also shown to be expressed in human endothelial cells and adipocytes of human abdominal adipose tissue. (PMID: 22768319,PMID: 28640441)