Tested Applications
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-84883-5 targets Integrin Alpha V in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species |
| Full Name | integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) |
| Calculated Molecular Weight | 1048 aa, 116 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC136442 |
| Gene Symbol | Integrin alpha V |
| Gene ID (NCBI) | 3685 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P06756 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 Integrin Alpha V antibody CL594-84883-5 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
