• Featured Product
  • KD/KO Validated

Integrin alpha-5/CD49e Monoclonal antibody, PBS Only

Integrin alpha-5/CD49e Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68561-1-PBS
Clone No.3B9E5

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

Integrin Alpha-5, ITGA5, 3B9E5, CD49 antigen-like family member E, CD49e

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68561-1-PBS targets Integrin alpha-5/CD49e in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33642

Product name: Recombinant human Integrin alpha-5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 749-1049 aa of BC008786

Sequence: FTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Predict reactive species
Full Name integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
Calculated Molecular Weight 115 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC008786
Gene Symbol Integrin alpha 5
Gene ID (NCBI) 3678
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08648
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha 5 (ITGA5), belongs to the integrin alpha chain family, primarily binds to Integrin beta 1 (ITGB1) to form an α5β1 heterodimer (PMID: 33711961). Integrin α5β1 is a specific receptor of fibronectin through its arginine-glycine-aspartic acid (RGD) binding site (PMID: 19608542). Integrin α5β1 plays roles in cell adhesion, migration and matrix formation, and has emerged as an essential mediator in many human carcinomas (PMID: 33408483).

Loading...
||
New chat Able
正在加载,请稍候...