Integrin beta-8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Integrin beta-8 Polyclonal antibody, PBS Only (29775-1-PBS)

• 

  WB analysis using 29775-1-AP (same clone as 29775-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29775-1-AP (Integrin beta-8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 29775-1-AP (same clone as 29775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29775-1-AP (Integrin beta-8 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 29775-1-AP (same clone as 29775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 29775-1-AP (Integrin beta-8 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29775-1-AP (same clone as 29775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29775-1-AP (Integrin beta-8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29775-1-AP (same clone as 29775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29775-1-AP (Integrin beta-8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29775-1-PBS in a different storage buffer formulation.

Integrin beta-8 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29775-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ITGB8, Integrin beta 8, integrin, beta 8

---

Product Information

29775-1-PBS targets Integrin beta-8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31137

  Product name: Recombinant human Integrin beta-8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 460-620 aa of NM_002214

  Sequence: KIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSI

• Full Name: integrin, beta 8
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: NM_002214
• Gene Symbol: Integrin beta 8
• Gene ID (NCBI): 3696
• RRID: AB_2935479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26012
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin beta-8 (ITGB8), belongs to the integrin beta chain family, contains an N-terminal signal peptide, a large extracellular domain that includes four cysteine-rich repeats, a transmembrane domain, and a C-terminal cytoplasmic domain (PMID: 1918072). Integrin beta-8 associates with integrin alpha-V (ITGAV) to form an αvβ8 heterodimer which has been shown to bind vitronectin, fibronectin, and a latency-associated peptide of TGF-β1/3 (PMID: 27033701). Integrin beta-8 contains multiple potential N-linked glycosylation sites. The observed molecular mass of approximately 95 kDa for integrin beta-8 is larger than the predicted 86 kDa, consistent with substantial glycosylation (PMID: 1918072).