Involucrin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Involucrin Polyclonal antibody (28462-1-AP)

• Featured Product
• KD/KO Validated

Involucrin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 28462-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

IVL

• 

  WB analysis of A431 using 28462-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 28462-1-AP (Involucrin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28462-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28462-1-AP (Involucrin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HaCaT using 28462-1-AP

  WB result of Involucrin antibody (28462-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Involucrin transfected HaCaT cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 28462-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 28462-1-AP (Involucrin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brown disease using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 28462-1-AP (Involucrin antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 28462-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 28462-1-AP (Involucrin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 28462-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Involucrin antibody (28462-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A431 using 28462-1-AP

  1x10^6 A431 cells were intracellularly stained with 0.4 ug Involucrin Polyclonal antibody (28462-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Involucrin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HaCaT cells, HT-1080 cells, HT-29 cells
• Positive IHC detected in: human tonsillitis tissue, human brown disease, human oesophagus cancer tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28462-1-AP targets Involucrin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29585

  Product name: Recombinant human Involucrin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-361 aa of NM_005547

  Sequence: EVPSKQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEG

• Full Name: involucrin
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_005547
• Gene Symbol: Involucrin
• Gene ID (NCBI): 3713
• RRID: AB_2881148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07476
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Involucrin is a protein precursor of the epidermal cornified envelope that is assembled in the outermost layers of the epidermis. Involucrin expression is restricted to the suprabasal epidermal layers (spinous and granular layers) during normal keratinocyte differentiation and is a useful marker of terminal differentiation. The predicted MW of involucrin is 68 kDa, but it also forms 120 kDa dimers, while different reports provided variable results ranging from 90-140 kDa. (PMID: 11099111, 1503502, 12150517)

Publications

What published studies show

The Involucrin Polyclonal antibody (Cat# 28462-1-AP) has 16 citations across journals including J Nanobiotechnology, Phytomedicine, Int J Biol Macromol, Oncogenesis, Int Immunopharmacol, Dis Model Mech, Transl Cancer Res, and others. Research fields span wound healing, atopic dermatitis and skin barrier repair, collagen biomaterials, squamous cell carcinoma, airway disease (COPD), organoid-based tumor immunity, keratinocyte differentiation, and plant biotechnology applications.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	J Nanobiotechnology; Exosomes from human induced pluripotent stem cells-derived keratinocytes accelerate burn wound healing through miR-762 mediated promotion of keratinocytes and endothelial cells migration.; Authors - Yunyao Bo
		Phytomedicine; Therapeutic effects of jaceosidin on atopic dermatitis via ubiquitin-mediated JAK1 degradation.; Authors - Ruoqu Wei
human	WB,IF	Int J Biol Macromol; Preparation of recombinant type I collagen (PF-I-80) and its functional characterization and biomedical applications in wound healing; Authors - Yan Zhang
	WB,IHC	J Ethnopharmacol; Protective effect of oligosaccharides isolated from Panax ginseng C. A. Meyer against UVB-induced skin barrier damage in BALB/c hairless mice and human keratinocytes.; Authors - Zhenzhuo Li
human	WB	J Agric Food Chem; Novel Collagen Analogs with Multicopy Mucin-Type Sequences for Multifunctional Enhancement Properties Using SUMO Fusion Tags; Authors - Zilong Zhao
human	IHC	Oncogenesis; A dominant SRCAP truncating mutation promotes squamous cell carcinoma progression.; Authors - Stephenie H. Droll