CoraLite® Plus 488-conjugated JAM-A/CD321 Recombinant monoclonal antibody

• 

  IF Staining of bEnd.3 using CL488-86229

  Immunofluorescent analysis of (4% PFA) fixed bEnd.3 cells using CoraLite® Plus 488 JAM-A/CD321 antibody (CL488-86229, Clone: 250060H5 ) at dilution of 1:200.

JAM-A/CD321 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86229

Clone No.250060H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IF/ICC

Synonyms

CD321, F11r, Jam1, JAM-1, JAM-A

---

Tested Applications

• Positive IF/ICC detected in: bEnd.3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86229 targets JAM-A/CD321 in IF/ICC applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3117

  Product name: Recombinant Mouse JAM-A/Junctional Adhesion Molecule A protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-238 aa of NM_172647.2

  Sequence: KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG

• Full Name: F11 receptor
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_172647.2
• Gene Symbol: F11r
• Gene ID (NCBI): 16456
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88792
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Junctional Adhesion Molecule-A (JAM-A), also known as CD321 or F11R, is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. It is primarily located in the tight junctions of epithelial and endothelial cells and is also expressed on circulating platelets and leukocytes (PMID: 34533648). Targeting F11R/JAM-A with monoclonal antibodies or peptide antagonists has shown promise in inhibiting tumor growth and metastasis in mouse models (PMID: 37563645).