KCC4/SLC12A7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCC4/SLC12A7 Polyclonal antibody, PBS Only (26590-1-PBS)

• 

  WB analysis using 26590-1-AP (same clone as 26590-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26590-1-AP (KCC4/SLC12A7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26590-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26590-1-AP (same clone as 26590-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 26590-1-AP (KCC4/SLC12A7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26590-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 26590-1-AP (same clone as 26590-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using KCC4/SLC12A7 antibody (26590-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26590-1-PBS in a different storage buffer formulation.

KCC4/SLC12A7 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26590-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

26590-1-PBS targets KCC4/SLC12A7 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24954

  Product name: Recombinant human SLC12A7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 953-1004 aa of BC098390

  Sequence: IHDRNTASHTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDL

• Full Name: solute carrier family 12 (potassium/chloride transporters), member 7
• Observed Molecular Weight: 119 kDa
• GenBank Accession Number: BC098390
• Gene Symbol: KCC4/SLC12A7
• Gene ID (NCBI): 10723
• RRID: AB_2918103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y666
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KCC4, also named as Solute carrier family 12 member 7(SLC12A7), is a 1083 amino-acid protein, which belongs to the SLC12A transporter family. As a multi-pass membrane protein, the molecular weight of KCC4 is 119 kDa. KCC4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. Moreover, KCC4 may mediate K+ uptake into Deiters' cells in the cochlea and contribute to K+ recycling in the inner ear. KCC4 is important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti(Uniprot, GeneID:10723).