KCNH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNH1 Polyclonal antibody, PBS Only (26426-1-PBS)

• 

  WB analysis using 26426-1-AP (same clone as 26426-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26426-1-AP (KCNH1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26426-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 26426-1-AP (same clone as 26426-1-PBS)

  IP result of anti-KCNH1 (IP:26426-1-AP, 4ug; Detection:26426-1-AP 1:5000) with rat brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 26426-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 26426-1-AP (same clone as 26426-1-PBS)

  IP result of anti-KCNH1 (IP:26426-1-AP, 4ug; Detection:26426-1-AP 1:5000) with mouse brain tissue lysate 2120 ug. This data was developed using the same antibody clone with 26426-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26426-1-AP (same clone as 26426-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26426-1-AP (KCNH1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26426-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 26426-1-AP (same clone as 26426-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 26426-1-AP (KCNH1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26426-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 26426-1-AP (same clone as 26426-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 26426-1-AP (KCNH1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26426-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KCNH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26426-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EAG, EAG channel 1, EAG1, Ether-a-go-go potassium channel 1, h eag

---

Product Information

26426-1-PBS targets KCNH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16647

  Product name: Recombinant human KCNH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 686-850 aa of BC113709

  Sequence: VKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANHSLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKT

• Full Name: potassium voltage-gated channel, subfamily H (eag-related), member 1
• Calculated Molecular Weight: 989 aa, 111 kDa
• Observed Molecular Weight: 111 kDa
• GenBank Accession Number: BC113709
• Gene Symbol: KCNH1
• Gene ID (NCBI): 3756
• RRID: AB_3742187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95259
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Potassium voltage-gated channel subfamily H member 1 (KCNH1, also known as Kv10.1 and EAG) a member of the EAG (ether-à-go-go) family, which is involved in intracellular signaling, cell proliferation, and tumorigenesis (PMID: 35639255). KCNH1 is mainly expressed in the adult central nervous system. It also plays a role in controlling K+ fux that regulates resting membrane potential in excitable and non-excitable cells and is activated at the onset of myoblast differentiation (PMID: 29333676; 27029528; 9738473).