KCNK4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNK4 Polyclonal antibody, PBS Only (27113-1-PBS)

• 

  WB analysis using 27113-1-AP (same clone as 27113-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27113-1-AP (KCNK4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27113-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse eye using 27113-1-AP (same clone as 27113-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 27113-1-AP (KCNK4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27113-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27113-1-AP (same clone as 27113-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27113-1-AP (KCNK4 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 27113-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27113-1-AP (same clone as 27113-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27113-1-AP (KCNK4 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 27113-1-PBS in a different storage buffer formulation.

KCNK4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27113-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27113-1-PBS targets KCNK4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25931

  Product name: Recombinant human KCNK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 261-393 aa of BC033577

  Sequence: SRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV

• Full Name: potassium channel, subfamily K, member 4
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC033577
• Gene Symbol: KCNK4
• Gene ID (NCBI): 50801
• RRID: AB_2880761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYG8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.